PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.1624s0003.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family EIL
Protein Properties Length: 628aa    MW: 71457.5 Da    PI: 5.2495
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.1624s0003.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3519.41.6e-158474261354
                          XXXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
                 EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasds 90 
                          +el++rmw+d+mll++lke++++    ke  ++++k+++s+eqarrkkmsraQDgiLkYMlk+mevc+aqGfvYgiipekgkpv+gasd+
  Kalax.1624s0003.1.p  47 DELERRMWRDRMLLRKLKEQNRS----KEG-IDSAKQRQSQEQARRKKMSRAQDGILKYMLKMMEVCKAQGFVYGIIPEKGKPVSGASDN 131
                          79******************998....787.9********************************************************** PP

                          XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HH CS
                 EIN3  91 LraWWkekvefdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelw 180
                          LraWWkekv+fdrngpaaiskyqa+n i+++++++++   s++hsl+elqDTtlgSLLsalmqhcdppqrrfplekg++pPWWPtG+e+w
  Kalax.1624s0003.1.p 132 LRAWWKEKVRFDRNGPAAISKYQADNCIPGRSEECDA-VGSTPHSLQELQDTTLGSLLSALMQHCDPPQRRFPLEKGIAPPWWPTGNEDW 220
                          ***********************************88.9*************************************************** PP

                          HHHHT--TT--.-----GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXX.XXXXXX CS
                 EIN3 181 wgelglskdqgtppykkphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecatvsah.ssslrk 269
                          w++lgl+kdqg+ppykkphdlkkawkvsvLtavikhm p+i++ir+l+rqsk+lqdkm+akes+++l+++nqee++ ++++++  + ++ 
  Kalax.1624s0003.1.p 221 WPQLGLPKDQGPPPYKKPHDLKKAWKVSVLTAVIKHMFPDIAKIRKLVRQSKCLQDKMTAKESATWLAIINQEEALSRKLYPDsCPPMSA 310
                          ***********************************************************************************5447888 PP

                          XXXXXXXXXXXXXXXXXXXXXX.XXXXXXXXXX...............................XXXXXXXXXXXXXXXXXXXXX..... CS
                 EIN3 270 qspkvtlsceqkedvegkkeskikhvqavktta...............................gfpvvrkrkkkpsesakvsskevsrt 328
                          +s ++++ + +++dveg +++  ++  ++k ++                               ++++ rkrk +++ +++++  + ++t
  Kalax.1624s0003.1.p 311 GSGSYVIGDISDYDVEGVDDEPSNEFVNQKPQDvnlynrrgggaldglmmqplvptvkteildgNLDFSRKRKLPSTVETQMMMDHKIYT 400
                          ****************5555554777777777789***************************************99999999888899** PP

                          .XXXXXXX.XXXXXXXXXXXXXXXXX CS
                 EIN3 329 cqssqfrgsetelifadknsisqney 354
                          c+  q+++ +++l+f d++s++++++
  Kalax.1624s0003.1.p 401 CEYPQCPYGDYRLGFLDRTSRNNHHM 426
                          ***********************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048732.3E-13147294No hitNo description
Gene3DG3DSA:1.10.3180.108.4E-76168304IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167681.31E-61173297IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 628 aa     Download sequence    Send to blast
MSIFEEMSFC GNLDFFSARP AEISVSPEVE PEATVEEDYT DDELDVDELE RRMWRDRMLL  60
RKLKEQNRSK EGIDSAKQRQ SQEQARRKKM SRAQDGILKY MLKMMEVCKA QGFVYGIIPE  120
KGKPVSGASD NLRAWWKEKV RFDRNGPAAI SKYQADNCIP GRSEECDAVG STPHSLQELQ  180
DTTLGSLLSA LMQHCDPPQR RFPLEKGIAP PWWPTGNEDW WPQLGLPKDQ GPPPYKKPHD  240
LKKAWKVSVL TAVIKHMFPD IAKIRKLVRQ SKCLQDKMTA KESATWLAII NQEEALSRKL  300
YPDSCPPMSA GSGSYVIGDI SDYDVEGVDD EPSNEFVNQK PQDVNLYNRR GGGALDGLMM  360
QPLVPTVKTE ILDGNLDFSR KRKLPSTVET QMMMDHKIYT CEYPQCPYGD YRLGFLDRTS  420
RNNHHMSCPY QNNSFSQGSA VQNFQIINDS AAPVAISFPQ PKPVTSFMNQ NASSQNPGLE  480
LPEDAHKRIS ELMSVYDANL HQNTSMDVAN FKRIDNQRHL PLEPQQLSQQ QQPQTKQTFQ  540
FQLDDNLHGQ RPMFGDSLPE EINMSFNNSV FSTNGVQFDQ TKLFDSQFGI NPNDGMPDFR  600
FESSFNFPCA DFSVDPPPKQ DMPIWYM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4zds_A3e-851713041134Protein ETHYLENE INSENSITIVE 3
4zds_B3e-851713041134Protein ETHYLENE INSENSITIVE 3
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002276380.10.0PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein
RefseqXP_010659025.10.0PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein
SwissprotO246060.0EIN3_ARATH; Protein ETHYLENE INSENSITIVE 3
TrEMBLF6HIW50.0F6HIW5_VITVI; Putative uncharacterized protein
STRINGVIT_13s0047g00250.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G20770.10.0EIL family protein